If you have been reading about pentadecapeptide and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-02-26. Where a claim depends on a specific study, the study is described rather than over-claimed.
Lyophilized peptide powder is generally stored at minus twenty degrees Celsius or lower and kept away from light and moisture. Under these conditions degradation is slow, and sealed vials remain stable for extended periods. Once dissolved, the material is less stable, particularly in aqueous buffers near neutral pH, where hydrolysis and oxidation proceed faster. Solutions are usually kept cold and used within days to weeks. Repeated freeze-thaw cycles are avoided because they encourage aggregation.
Identity and purity are established using reversed-phase high-performance liquid chromatography, which separates the peptide from related impurities and yields a percentage purity. Mass spectrometry, typically with electrospray ionization, confirms the molecular mass against the expected value. Amino acid analysis or peptide mapping provides additional sequence confirmation. These methods are complementary, since chromatography measures how much material is present while mass spectrometry verifies what that material is. A certificate of analysis normally reports both.
BPC-157 is a synthetic peptide built from fifteen amino acid residues. Its sequence comes from a larger protein fragment that researchers isolated from human gastric juice and described as a body protection compound. The fragment contains glycine, glutamic acid, five prolines, lysine, alanine, two aspartic acids, leucine, and valine. The number 157 in the name refers to the position of the stretch within the parent protein. Material used in laboratories is manufactured rather than extracted from stomach fluid.
The molecule carries 15 residues, a molar mass near 1419.5 g/mol, and the formula C62H98N16O22. Its structure features a proline-rich central region, a pair of adjacent aspartic acid residues, and no cysteine. The absence of cysteine means no disulfide bonds can form, which simplifies refolding and reconstitution. Suppliers usually ship the material as a freeze-dried powder that appears white to off-white. It dissolves readily in water and in saline solutions.
| Property | Value | Notes |
|---|---|---|
| Appearance | white to off-white powder | lyophilized form |
| Typical purity | 95 percent or higher by RP-HPLC | value depends on method |
| Storage temperature | minus 20 degrees Celsius or below | desiccated, protected from light |
| Reconstitution solvent | bacteriostatic water | sterile saline also used |
| Primary assay | RP-HPLC with UV detection | often paired with mass spectrometry |
Dry powder is generally stored at low temperature, with minus twenty degrees Celsius or colder advised for extended retention. Reconstituted solutions are less stable than the solid form and are normally kept cold and shielded from repeated freeze-thaw cycles. Light exposure is avoided because some peptides degrade under ultraviolet radiation. The exact rate of degradation depends on concentration, pH, and the presence of salts, so a single shelf life does not apply to every preparation. Reported stability figures should be read as indicative of typical handling rather than as universal constants.
Confirmation of identity and purity relies on standard peptide analysis techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and serves as the most common purity assay. Mass spectrometry, often coupled to that chromatography step, provides an accurate molecular mass that can be matched against the expected value. Amino acid analysis or sequencing can be added for further confirmation. Because short peptides can be produced by different synthetic routes, laboratories usually report both a chromatographic purity percentage and a mass confirmation rather than a single figure.
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
=== Fish diseases, parasites and vaccines === A major difficulty for aquaculture is the tendency towards monoculture and the associated risk of widespread disease. Aquaculture is also associated with environmental risks; for instance, shrimp farming has caused the destruction of important mangrove forests throughout southeast Asia. In the 1990s, disease wiped out China's farmed Farrer's scallop and white shrimp and required their replacement by other species.
Historian David Gates called it the "Spanish ulcer". Napoleon realised it had been a disaster for his cause, writing later, "That unfortunate war destroyed me ... All the circumstances of my disasters are bound up in that fatal knot." The Peninsular campaigns witnessed 60 major battles and 30 major sieges, more than any other of the Napoleonic conflicts, and lasted over six years, far longer than any of the others. France and her allies lost at least 91,000 killed in action and 237,000 wounded in the peninsula. From 1812, the Peninsular War merged with the War of the Sixth Coalition. That same year, Britain had a change in leadership, as the prime minister Spencer Perceval was assassinated and Robert Jenkinson took over the leadership of the country and remained the prime minister in charge until the end of the Napoleonic wars.
=== Modern corals === The currently ubiquitous stony corals, Scleractinia, appeared in the Middle Triassic to fill the niche vacated by the extinct rugose and tabulate orders and is not closely related to the earlier forms. Unlike the corals prevalent before the Permian extinction, which formed skeletons of a form of calcium carbonate known as calcite, modern stony corals form skeletons composed of aragonite. Their fossils are found in small numbers in rocks from the Triassic period, and become common in the Jurassic and later periods. Although they are geologically younger than the tabulate and rugose corals, the aragonite of their skeletons is less readily preserved, and their fossil record is accordingly less complete.
Sources: en.wikipedia.org
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
intrinsically disordered protein (IDP) A protein (or a region or domain within a protein) that lacks any distinct, fixed three-dimensional structure or organization under physiological conditions, instead changing continuously and randomly between multiple transient conformational states rather than folding into any one stable conformation, especially in the absence of specific macromolecular interaction partners. The majority of eukaryotic proteins contain domains with intrinsic structure alongside unstructured domains. Peptide sequences lacking intrinsic order are generally characterized by high proportions of charged and hydrophilic amino acids and low proportions of hydrophobic amino acids, making them inherently flexible, accessible, and modifiable, which allows the same peptide sequence to have distinct functions across a wide variety of biochemical circumstances. They are frequently enriched in binding motifs and are common targets of post-translational modifications, giving them important roles in cell signaling pathways and as hubs in protein complexes.
Kissinger tried to persuade Thọ that he had nothing to fear from the United States in the long term, and asked: "when we can live with governments that are not pro-American in the largest Asian nations, why should we insist on a government that is pro-American in Saigon?" Tho charged that Kissinger was bringing nothing new.
Anemia with a low MCHC is called hypochromic anemia. If anemia is present but the red blood cell indices are normal, the anemia is considered normochromic and normocytic. The term hyperchromia, referring to a high MCHC, is generally not used. Elevation of the MCHC above the upper reference value is rare, mainly occurring in conditions such as spherocytosis, sickle cell disease and hemoglobin C disease. An elevated MCHC can also be a false result from conditions like red blood cell agglutination (which causes a false decrease in the red blood cell count, elevating the MCHC) or highly elevated amounts of lipids in the blood (which causes a false increase in the hemoglobin result). Microcytic anemia is typically associated with iron deficiency, thalassemia, and anemia of chronic disease, while macrocytic anemia is associated with alcoholism, folate and B12 deficiency, use of some drugs, and some bone marrow diseases. Acute blood loss, hemolytic anemia, bone marrow disorders, and various chronic diseases can result in anemia with a normocytic blood picture. The MCV serves an additional purpose in laboratory quality control. It is relatively stable over time compared to other CBC parameters, so a large change in MCV may indicate that the sample was drawn from the wrong patient.
Sources: en.wikipedia.org
Bacteriostatic water or sterile saline is commonly used to dissolve the powder. The choice of solvent affects stability and preservation. Aqueous solutions are kept refrigerated and are not intended for long-term storage.
Most suppliers state a purity of ninety-five percent or higher by reversed-phase chromatography. Values below that threshold indicate a larger proportion of related peptides. The reported figure depends on the detection wavelength, usually 214 nanometers for peptides.
Sealed vials kept cold and dry retain potency for years in many cases. Exposure to warmth or moisture accelerates degradation. A stated expiration date is a supplier estimate rather than a measured endpoint.
It does not occur in the form that is supplied commercially. Its sequence matches a fragment of a larger gastric protein, and the research material is produced synthetically in a laboratory. The fragment described in the early literature is generally the same synthetic pentadecapeptide.